Analytical Data
-
Gene name
hns
- Application
-
Alternative Names
hns;hnsA;osmZ;DNA-binding Protein H-NS
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0ACF8
-
Expression Region
2-137aa
-
AA Sequence
SEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
-
Molecular Weight
19.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HNS (H-NS, a histone-like nucleoid structuring protein) is a key player in bacterial gene regulation and DNA organization. Research on HNS has gained momentum due to its crucial role in managing the expression of virulence genes and responding to environmental signals in pathogenic bacteria. Studies have shown that HNS helps compact bacterial DNA, thereby influencing transcriptional regulation and contributing to the overall cellular stress response. Given its involvement in important processes such as biofilm formation, motility, and acute infection, understanding HNS at the molecular level is vital for developing new antimicrobial strategies. The reconstitution of HNS as a recombinant protein allows for detailed analysis of its biochemical properties, interaction with DNA, and the mechanism through which it regulates gene expression. This research background sets the stage for exploring HNS's potential as a target for novel therapeutic interventions, particularly against antibiotic-resistant strains, making it a significant focus in microbiology and biotechnology fields. Through such studies, insights into HNS function may lead to innovative solutions for combating bacterial infections.











