Cat: PA1000-5978

Recombinant Human DDOST Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DDOST

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DDOST;KIAA0115;OST48;Dolichyl-diphosphooligosaccharide--Protein glycosyltransferase 48 kDa subunit

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P39656

  • Expression Region

    1-456aa

  • AA Sequence

    MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVL LDNLNVRETHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIF SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD EEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGV GMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQAR NNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVF KEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDG DDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYT HLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK EKEKSD

  • Molecular Weight

    77 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DDOST, or Dolichyl-Diphosphooligosaccharide-Protein Glycosyltransferase, is an essential enzyme that plays a pivotal role in the N-glycosylation process, which is critical for protein folding and function in eukaryotic cells. Emerging as a significant focus in biochemical research, DDOST catalyzes the transfer of pre-assembled oligosaccharides onto nascent polypeptides within the endoplasmic reticulum, facilitating proper protein maturation and stability. Disturbances in DDOST function have been associated with various diseases, including genetic disorders and cancers, underscoring its importance in cellular homeostasis. The study of DDOST’s role in glycosylation is crucial for understanding how glycomic changes affect physiological and pathological processes. Furthermore, the potential therapeutic applications of manipulating DDOST activity or its pathways to treat related diseases highlight the importance of ongoing research in this area. By creating recombinant forms of DDOST, scientists aim to elucidate its structural and functional properties, leading to innovations in targeted therapies and biotechnological applications. The investigation of DDOST also promises to provide insights into glycosylation patterns that could serve as biomarkers for disease diagnosis and treatment stratification. As such, the exploration of DDOST as a protein model forms a critical dimension in the fields of glycobiology, biochemistry, and pharmaceutical science, paving the way for advances in understanding complex biological systems and developing novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US