Cat: PA1000-5952

Recombinant Human MMP12 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MMP12

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MMP12;HME;Macrophage metalloelastase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P39900

  • Expression Region

    1-470aa

  • AA Sequence

    MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPV TKMKYSGNLMKEKIQEMQHFLGLKVTGQLDTSTLEMMHAPRCGVPDVHHF REMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFS KINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDED EFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRL SADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFF FKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDD KYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQY WRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFFQGSNQFE YDFLLQRITKTLKSNSWFGC

  • Molecular Weight

    80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Matrix metalloproteinase-12 (MMP12), also known as macrophage metalloelastase, is an important enzyme involved in the degradation of extracellular matrix components, playing a crucial role in various physiological and pathological processes, including tissue remodeling, wound healing, and inflammation. Its specificity for elastin and other extracellular matrix substrates links it to several diseases, particularly those characterized by excessive tissue remodeling such as chronic obstructive pulmonary disease (COPD), atherosclerosis, and cancer. Research on MMP12 has gained momentum due to its potential as a therapeutic target and biomarker. Its expression is primarily regulated by pro-inflammatory cytokines, making it a key player in inflammatory responses. Investigating MMP12 in the context of disease mechanisms has elucidated its contribution to the pathogenesis of chronic inflammatory diseases and tissue damage. The production of recombinant MMP12 protein facilitates detailed studies of its structure, function, and interactions with inhibitors and substrates, paving the way for the development of novel therapeutic strategies. Understanding MMP12's role at the molecular level offers insights into its involvement in disease processes and may lead to innovative approaches for modulating its activity in various clinical settings. This research contributes to the broader understanding of metalloproteinase families and their implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US