Analytical Data
-
Gene name
entG
- Application
-
Alternative Names
entG；entG；Enterobactin synthase component B
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A0L7
-
Expression Region
26-258aa
-
AA Sequence
QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
-
Molecular Weight
43.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EntG, a key player in the biosynthetic pathway of enterobactin, is an important siderophore produced by various Enterobacteriaceae. The significance of EntG lies in its role in iron acquisition, a vital process for bacterial survival and virulence, particularly in nutrient-limited environments. Siderophores like enterobactin form strong complexes with iron, facilitating its transport into bacterial cells, thus enhancing pathogenicity. Understanding the structure and function of EntG is crucial as it may provide insights into the mechanisms of iron acquisition in pathogens, revealing potential targets for novel antimicrobial therapies. Recent studies have focused on the recombinant production of EntG to investigate its biochemical properties and interactions within the biosynthetic pathway. By leveraging techniques like recombinant DNA technology, researchers can produce active EntG in a controlled setting, allowing for detailed studies on its enzymatic activity, substrate specificity, and structural characteristics. This research not only aims to elucidate the fundamental biological roles of EntG but also to explore its potential implications in drug development, especially in the face of rising antibiotic resistance. Consequently, EntG represents a fascinating subject for both fundamental microbiology and applied biomedical research, emphasizing the intersection of bacterial survival mechanisms and therapeutic strategies.
