Analytical Data
-
Gene name
CCDC108
- Application
-
Alternative Names
CFAP65; CCDC108Cilia- and flagella-associated Protein 65; Coiled-coil domain-containing Protein 108
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZU64
-
Expression Region
1-163aa
-
AA Sequence
MLTQAPSSVVRSRNSRNHTVNSGGSCLSASTVAIPAINDSSAAMSACSTISAQPASSMDTQMHSPKKQERVNKRVIWGIEVAEELHWKGWELGKETTRNLVLKNRSLKLQKMKYRYQYKGSRTQCHSLEPRKQALFKTKQNKQKKPLTCHIKASECLKYMQYE
-
Molecular Weight
44.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC113 is a member of the coiled-coil domain-containing protein family, which is implicated in various cellular processes including cytoskeletal organization, intracellular transport, and signal transduction. Recent studies have highlighted the potential roles of CCDC113 in human health and disease, particularly in relation to cellular proliferation and differentiation. Dysregulation of proteins within the coiled-coil domain family has been associated with several pathological conditions, including cancer and genetic disorders. Given the emerging evidence linking CCDC113 to these critical biological functions, researchers have focused on characterizing its structure and function through the study of recombinant proteins. This approach allows for in-depth analysis of its interactions with other cellular components and its influence on cellular mechanisms. Understanding the biochemical properties and physiological roles of CCDC113 could provide insights into its involvement in health and disease, paving the way for potential therapeutic applications. Additionally, investigating the implications of CCDC113 in various cellular contexts offers a promising avenue for elucidating the complexities of coiled-coil proteins in cellular biology.
