Cat: PA2000-2775

Recombinant E.coli virE2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    virE2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    virE2;Single-strand DNA-binding Protein

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0A3W9

  • Expression Region

    316-533aa

  • AA Sequence

    NRAHNRQFPTATVNMGQQPDGQGGLTRDRHVSVEFLMQSAPNSPWAQALKKGELWDRVQLLARDGNRYLSPHRLEYSDPEHFTELMNRVGLPASMGRQSHAASIKFEKFDAQAAVIVINGPELRDIHDLSPENLQNVSTKDVIVADRNENGQRTGTYTSVAEYERLQLRLPADAAGVLGEAADKYSRDFVRPEPASRPISDSRRIYESRPRSQSVNSF

  • Molecular Weight

    31.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VirE2 protein, encoded by the Agrobacterium tumefaciens pTi virulence plasmid, plays a crucial role in the transformation of plant cells by acting as a key component in the delivery of T-DNA into the host genome. Understanding the structure and function of VirE2 is essential for exploiting its properties in biotechnology and genetic engineering. Research has shown that VirE2 forms a complex with T-DNA during its transport, facilitating nuclear import and integration into the plant's DNA. This interaction is vital for the Agrobacterium-mediated genetic transformation process, which has significant applications in generating transgenic plants and improving agricultural traits. Investigating the biochemical properties and interactions of VirE2 can enhance our understanding of its mechanism of action and enable the development of novel tools for plant transformation. Furthermore, the potential use of VirE2 as a vector for delivering genetic material into eukaryotic cells expands its significance beyond plant biology into broader fields such as medicine and biotechnology. Recent studies focus on the optimization of VirE2 for increased efficiency and specificity in delivering therapeutic genes, highlighting its importance in the advancement of gene therapy methods. Overall, the exploration of VirE2 as a recombinant protein not only sheds light on fundamental plant-pathogen interactions but also opens avenues for innovative biotechnological applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US