Analytical Data
-
Gene name
cry1Ac
- Application
-
Alternative Names
cry1Ac；cry1A(c)；cry218；cryIA(c)；Pesticidal crystal Protein Cry1Ac
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05068
-
Expression Region
972-1178aa
-
AA Sequence
LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
-
Molecular Weight
25.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cry1Ac recombinant protein, derived from the bacterium Bacillus thuringiensis (Bt), is a crucial element in the field of agricultural biotechnology, particularly for its role in insect pest control. This protein is part of the Cry toxin family, known for its insecticidal properties against various lepidopteran pests, which are significant threats to crops such as cotton, corn, and soybeans. The molecular mechanism of Cry1Ac involves its binding to specific receptors in the gut of susceptible insects, leading to cell lysis and ultimately, insect death. Research into recombinant Cry1Ac focuses on enhancing its effectiveness, stability, and specificity, as well as exploring its potential for incorporation into genetically modified (GM) crops. By introducing the gene encoding Cry1Ac into plant genomes, scientists aim to develop crops with built-in resistance to pests, thereby reducing reliance on chemical pesticides, promoting sustainable agriculture, and improving crop yields. Additionally, studies have been conducted to assess the safety and environmental impact of Cry1Ac proteins, ensuring they do not adversely affect non-target organisms or human health. The advancement of genetic engineering techniques, such as CRISPR and synthetic biology, continues to optimize Cry1Ac applications, making it a subject of extensive research and commercial interest. Overall, the study of Cry1Ac recombinant protein represents a significant intersection of microbiology, genetics, and agricultural science, aiming to address global food security challenges while minimizing environmental footprints.
