Analytical Data
-
Gene name
CBX1
- Application
-
Alternative Names
HP1Hsbeta;Heterochromatin Protein 1 homolog beta;HP1 beta;Heterochromatin Protein p25;M31;Modifier 1 Protein;p25beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P83916
-
Expression Region
1-185aa
-
AA Sequence
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
-
Molecular Weight
26.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CBX1, or Chromobox 1, is a pivotal protein involved in epigenetic regulation, particularly in the formation and maintenance of heterochromatin. It belongs to the Polycomb group of proteins and is known for its role in gene silencing through the recognition of trimethylated lysine 9 on histone H3 (H3K9me3). Research into CBX1 has gained momentum due to its implications in various biological processes, including development, cell differentiation, and the maintenance of stem cell properties. Moreover, aberrations in CBX1 expression and function have been linked to several diseases, including cancer, making it a potential target for therapeutic strategies. Investigating CBX1 recombinant protein can provide insights into its functional mechanisms and interactions with other proteins within the chromatin landscape, further elucidating its role in epigenetic regulation. Furthermore, the development of recombinant CBX1 not only facilitates the study of its structural properties but also allows for high-throughput screening in drug discovery. Understanding the dynamics of CBX1 and its interaction with histones may unveil novel epigenetic modifiers and therapeutic avenues, particularly in oncology where epigenetic changes play a critical role in tumorigenesis and progression. Thus, the study of CBX1 is critical for advancing our knowledge of epigenetic regulation and its implications in health and disease.
