Cat: PA2000-2761

Recombinant Human ptxA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ptxA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ptxA;Phosphite import ATP-binding Protein PxtA

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7W2U8

  • Expression Region

    35-269aa

  • AA Sequence

    DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLEHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEIRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRTVTRVYHNGITGETTTTEYPNLRYVSQQTRANTNPYTSRRSTASIVGTLVRMAPVTGACMARQAESPEAMAAWSERTGEAMVLVYYESIAYSF

  • Molecular Weight

    33.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of the ptxA gene, which encodes for the pertussis toxin (PT) production in Bordetella pertussis, has gained significant attention due to its role in the pathogenesis of whooping cough, a highly contagious respiratory disease. Understanding ptxA is crucial for vaccine development and improving therapeutic strategies. Pertussis toxin is a major virulence factor, contributing to bacterial adhesion and immune evasion. Recombinant expression of ptxA allows researchers to produce the pertussis toxin in a controlled environment, facilitating the investigation of its structure-function relationships. By utilizing various expression systems, including prokaryotic and eukaryotic platforms, scientists aim to better understand its immunogenic properties and potential as a vaccine component. Additionally, studies focusing on ptxA reconstitution help elucidate the molecular mechanisms underlying whooping cough, as well as the host's immune response to the toxin. Overall, the ongoing research on ptxA recombinant proteins is instrumental in advancing our knowledge of pertussis biology and enhancing public health interventions against this reemerging disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US