Analytical Data
-
Gene name
CARD11
- Application
-
Alternative Names
0610008L17Rik; 2410011D02Rik; Bcl10 interacting maguk Protein 3; BIMP 3; BIMP3; CAR11_HUMAN; CARD 11; CARD containing MAGUK Protein 3; Card maguk Protein 1; CARD-containing MAGUK Protein 1; CARD11
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXL7
-
Expression Region
481-580aa
-
AA Sequence
KYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTV
-
Molecular Weight
36.74 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CARD11 is a pivotal protein involved in the regulation of immune responses, primarily functioning as a scaffold in the signaling pathways of various immune receptors, particularly in B cells and T cells. Its significance lies in its ability to integrate signals from cell surface receptors, leading to the activation of downstream pathways such as the NF-kB pathway, which is crucial for lymphocyte proliferation and differentiation. Dysregulation or mutations in CARD11 have been linked to various immunological disorders, including primary immunodeficiencies and lymphoid malignancies. Research has increasingly focused on the structure and function of CARD11, particularly through the study of its recombinant forms, to understand its mechanistic role in immune signaling. By exploring how CARD11 interacts with other signaling molecules and the consequences of its modification, scientists aim to unravel the complexities of immune regulation and identify potential therapeutic targets for treating related diseases. The development and characterization of CARD11 recombinant proteins is essential for delineating its structure-function relationship and for providing insights into novel treatment strategies for immune-related conditions.
