Analytical Data
-
Gene name
C9orf80
- Application
-
Alternative Names
SOSS complex subunit C. INTS3- and NABP-interacting Protein. Sensor of single-strand DNA complex subunit C. Sensor of ssDNA subunit C. SOSS-C. Single-stranded DNA-binding Protein-interacting Protein 1. SSB-interacting Protein 1. hSSBIP1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRY2
-
Expression Region
1-104aa
-
AA Sequence
MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE
-
Molecular Weight
37.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf80, a protein encoded by the C9orf80 gene located on chromosome 9, has garnered attention in recent years due to its potential role in various biological processes and diseases. Initial studies suggested that C9orf80 might be involved in cellular responses to stress and inflammation, which are critical in numerous pathological conditions, including neurodegenerative diseases and certain types of cancer. Its function remains largely unexplored, making it a candidate for detailed investigation. As a recombinant protein, C9orf80 can be produced and purified for further studies, facilitating the examination of its structure, interactions, and functional implications in cellular pathways. Understanding C9orf80's mechanisms could reveal novel therapeutic targets and contribute to our knowledge of gene regulation, protein interactions, and the intricacies of disease mechanisms. Thus, research into C9orf80 holds promise for advancing biomedical science and improving our grasp of complex health issues.
