Analytical Data
-
Gene name
C9orf62
- Application
-
Alternative Names
C9orf62Putative uncharacterized Protein C9orf62
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N4C0
-
Expression Region
1-152aa
-
AA Sequence
MGLSPGQTSVSFLWPLLEVRDHNTGRGLVPATVLTPGSPETLLELRQAFLGSRQARHGHDAAPSSGQQGCSVDRTAGRPVLGWRLRNSLTGQEGRQHLHLSGIRTSRKAKEYKPVFFGATEISVLMAVAESLREPPPPQWGWFLSSLFLKIF
-
Molecular Weight
43.1 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf62 is a gene located on chromosome 9, and it has garnered significant attention in recent years due to its association with neurodegenerative diseases, particularly amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD). Research indicates that mutations and expansions in the C9orf72 gene, which is closely linked to C9orf62, can lead to the production of abnormal proteins that may contribute to the pathogenesis of these disorders. Understanding the function and mechanisms of C9orf62, including its role in cellular processes such as stress response and neuronal health, is essential for uncovering the molecular underpinnings of ALS and FTD. The study of C9orf62 recombinant proteins has become an important area of research, as it allows scientists to investigate the biochemical properties, interactions, and potential pathogenic effects of C9orf62-related proteins in vitro. By analyzing C9orf62 protein behavior in various experimental models, researchers aim to identify therapeutic targets and biomarkers for early diagnosis, ultimately contributing to the development of effective treatments for these debilitating diseases. Given the rising prevalence of ALS and FTD and the challenges in diagnosing and treating these conditions, continuing research on C9orf62 and its associated proteins is critical for advancing our understanding of neurodegeneration and improving patient outcomes.
