Cat: PA1000-5679

Recombinant Human CA4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CA4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CA4;Voltage-dependent calcium channel subunit alpha-2/delta-4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22748

  • Expression Region

    19-283aa

  • AA Sequence

    AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLG RFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHW SDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAF LVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYF RYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYY DKEQTVSMKDNVRPLQQLGQRTVIK

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CA4, or Carbonic Anhydrase IV, is an important enzyme that plays a critical role in various physiological processes, including the regulation of acid-base balance, ion transport, and carbon dioxide hydration. It is predominantly found in epithelial tissues, particularly in the kidneys, lungs, and gastrointestinal tract. Research on CA4 has gained significant attention in recent years due to its potential implications in various diseases, such as cancer, glaucoma, and neurodegenerative disorders. The enzyme's unique structure allows for rapid interconversion between carbon dioxide and bicarbonate, making it essential in maintaining physiological pH levels and facilitating respiratory gas exchange. Additionally, CA4 is implicated in the acidification of the renal tubular fluid, crucial for proper kidney function. Advances in recombinant DNA technology have enabled the production of CA4 in various expression systems, allowing researchers to study its biochemical properties, interactions, and inhibitors. Understanding the mechanisms by which CA4 operates can provide insights into potential therapeutic targets for treating related diseases. Moreover, the exploration of CA4 as a biomarker for certain conditions is an emerging area of investigation, highlighting its relevance in clinical diagnostics. Overall, the study of recombinant CA4 not only expands our knowledge of enzyme biochemistry but also opens new avenues for therapeutic interventions in related health issues.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US