Analytical Data
-
Gene name
CA4
- Application
-
Alternative Names
CA4；Voltage-dependent calcium channel subunit alpha-2/delta-4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22748
-
Expression Region
19-283aa
-
AA Sequence
AESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLG RFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHW SDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAF LVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYF RYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYY DKEQTVSMKDNVRPLQQLGQRTVIK
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CA4, or Carbonic Anhydrase IV, is an important enzyme that plays a critical role in various physiological processes, including the regulation of acid-base balance, ion transport, and carbon dioxide hydration. It is predominantly found in epithelial tissues, particularly in the kidneys, lungs, and gastrointestinal tract. Research on CA4 has gained significant attention in recent years due to its potential implications in various diseases, such as cancer, glaucoma, and neurodegenerative disorders. The enzyme's unique structure allows for rapid interconversion between carbon dioxide and bicarbonate, making it essential in maintaining physiological pH levels and facilitating respiratory gas exchange. Additionally, CA4 is implicated in the acidification of the renal tubular fluid, crucial for proper kidney function. Advances in recombinant DNA technology have enabled the production of CA4 in various expression systems, allowing researchers to study its biochemical properties, interactions, and inhibitors. Understanding the mechanisms by which CA4 operates can provide insights into potential therapeutic targets for treating related diseases. Moreover, the exploration of CA4 as a biomarker for certain conditions is an emerging area of investigation, highlighting its relevance in clinical diagnostics. Overall, the study of recombinant CA4 not only expands our knowledge of enzyme biochemistry but also opens new avenues for therapeutic interventions in related health issues.
