Analytical Data
-
Gene name
C9orf37
- Application
-
Alternative Names
ARRDC1-AS1; C9orf37; AD038Uncharacterized Protein ARRDC1-AS1; ARRDC1 antisense RNA 1; ARRDC1 antisense gene Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H2J1
-
Expression Region
1-176aa
-
AA Sequence
MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGA
-
Molecular Weight
44.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf37 is a gene located on chromosome 9 that has garnered significant interest due to its potential association with various neurodegenerative diseases, particularly frontotemporal dementia (FTD) and amyotrophic lateral sclerosis (ALS). Recent genomic studies have identified mutations in this gene, linking them to both familial and sporadic cases of these disorders. Understanding the protein encoded by C9orf37 is crucial, as it may play a role in cellular functions that contribute to neurodegenerative pathology. The research surrounding the recombinant C9orf37 protein focuses on elucidating its structural and functional characteristics, which might shed light on its biological role and involvement in neurodegenerative processes. Experimental studies aim to produce high-quality recombinant C9orf37 protein for in vitro analyses, allowing scientists to investigate its interactions with other cellular components and its impact on neuronal health. By examining the protein's properties, researchers hope to uncover mechanisms that lead to neurodegeneration and identify potential therapeutic targets. The study of C9orf37 not only enhances our understanding of its specific functions but also contributes to the broader field of neurobiology, offering insights into the molecular underpinnings of diseases that significantly impact the aging population.
