Analytical Data
-
Gene name
C9orf127
- Application
-
Alternative Names
TMEM8B; C9orf127; NGX6; Transmembrane Protein 8B; Nasopharyngeal carcinoma-associated gene 6 Protein; Protein NAG-5; Protein NGX6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NDV4
-
Expression Region
1-257aa
-
AA Sequence
MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK
-
Molecular Weight
54.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C9orf127, also known as the "C9 open reading frame 127," has garnered significant attention in recent years due to its potential implications in various biological processes and diseases. Located on chromosome 9, this gene encodes a protein that is believed to play a critical role in cellular functions, although its exact mechanism of action remains largely unexplored. Emerging research suggests that C9orf127 may be involved in modulating immune responses and influencing cellular signaling pathways, making it a candidate for studying conditions such as cancer, neurodegenerative diseases, and autoimmune disorders. The recombinant expression of C9orf127 facilitates in-depth investigations into its structural and functional properties, allowing researchers to better understand how this protein interacts within cellular networks. Additionally, the production of recombinant C9orf127 provides valuable material for developing potential therapeutic strategies or biomarker identification, which could lead to novel approaches for diagnosing and treating related diseases. As researchers continue to uncover the roles of C9orf127 in health and disease, it is anticipated that this protein will become an important focus of study in molecular biology and therapeutic development.











