Cat: PA2000-6364

Recombinant Human C9orf127 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C9orf127

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMEM8B; C9orf127; NGX6; Transmembrane Protein 8B; Nasopharyngeal carcinoma-associated gene 6 Protein; Protein NAG-5; Protein NGX6

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A6NDV4

  • Expression Region

    1-257aa

  • AA Sequence

    MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK

  • Molecular Weight

    54.7 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C9orf127, also known as the "C9 open reading frame 127," has garnered significant attention in recent years due to its potential implications in various biological processes and diseases. Located on chromosome 9, this gene encodes a protein that is believed to play a critical role in cellular functions, although its exact mechanism of action remains largely unexplored. Emerging research suggests that C9orf127 may be involved in modulating immune responses and influencing cellular signaling pathways, making it a candidate for studying conditions such as cancer, neurodegenerative diseases, and autoimmune disorders. The recombinant expression of C9orf127 facilitates in-depth investigations into its structural and functional properties, allowing researchers to better understand how this protein interacts within cellular networks. Additionally, the production of recombinant C9orf127 provides valuable material for developing potential therapeutic strategies or biomarker identification, which could lead to novel approaches for diagnosing and treating related diseases. As researchers continue to uncover the roles of C9orf127 in health and disease, it is anticipated that this protein will become an important focus of study in molecular biology and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US