Cat: PA2000-2638

Recombinant Human BETVIII Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BETVIII

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BETVIII;Calcium-binding allergen Bet v 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P43187

  • Expression Region

    1-205aa

  • AA Sequence

    MPCSTEAMEKAGHGHASTPRKRSLSNSSFRLRSESLNTLRLRRIFDLFDK NSDGIITVDELSRALNLLGLETDLSELESTVKSFTREGNIGLQFEDFISL HQSLNDSYFAYGGEDEDDNEEDMRKSILSQEEADSFGGFKVFDEDGDGYI SARELQMVLGKLGFSEGSEIDRVEKMIVSVDSNRDGRVDFFEFKDMMRSV LVRSS

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BETVIII (Bromodomain and Extra-Terminal Domain-containing protein VIII) is a member of the bromodomain and extraterminal (BET) protein family, which plays a crucial role in regulating gene expression. Research on BET proteins has gained significant attention due to their involvement in various cellular processes, including transcriptional regulation, chromatin remodeling, and cell differentiation. BETVIII, in particular, has been implicated in the pathogenesis of several diseases, including cancer and inflammatory disorders, making it a potential therapeutic target. The study of the structural and functional properties of BETVIII is essential for understanding its precise role in these biological processes. Advances in techniques such as cryo-electron microscopy and X-ray crystallography have enabled researchers to elucidate the complex interactions between BETVIII and its binding partners, paving the way for the development of small-molecule inhibitors that could disrupt these interactions. As a result, the investigation of BETVIII and its potential as a drug target represents a promising avenue for innovative therapeutic strategies aimed at treating diseases associated with dysregulated gene expression.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US