Analytical Data
-
Gene name
C8orf34
- Application
-
Alternative Names
C8orf34Uncharacterized Protein C8orf34; Protein VEST-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q49A92
-
Expression Region
1-538aa
-
AA Sequence
MSSPLASELSELAALRPGFRLSAPHARVAPRAATHARGRGRASHAGQPRLRSSCPGPSPGKRRVVPSGGAQPRVLPALSSRSHLFPMASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESKGTRRDFRSYDKPWQLNAKKPKKSKSDLAVSNISPPSPDSKSLPRSVEHPKWNWRTKPQSRDFDELNHILQESKKLGKALENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRSKNDQWESEDSGSSPAGSLKMEPKNKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDNEDDAMELLEDLNDLRMEGVTTLVPSGSKFNQGRPTYPAEPQAKVTLNICSRCARLQGDNLEERTEESLPILHSPDEKIPDSFDSLPGTEEALMEEGDEFEKASKLTGPGEASSGVGHSLKNYMEEDESLKQLQVVHQPWILPSDTESEGVEAEQEKRSADLLLCVPCSSCPTLVYSGL
-
Molecular Weight
59.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C8orf34, also known as "Chromosome 8 Open Reading Frame 34," is a relatively uncharacterized gene located on chromosome 8, which has recently garnered attention in the field of molecular biology and genetic research. Its potential roles in cellular processes and disease mechanisms are under investigation, with particular interest in its implications for human health. Although it is classified as a poorly characterized protein, preliminary studies suggest that C8orf34 may be involved in various biological pathways, potentially influencing cell differentiation and proliferation. Research has indicated that C8orf34 expression levels can vary in different tissues and may be associated with certain pathological conditions, including malignancies. This makes it a candidate for further exploration in cancer research, where understanding the function and regulation of such novel proteins could provide insight into tumorigenesis and therapeutic targets. Studies are being conducted to investigate the recombinant expression of C8orf34, employing techniques such as molecular cloning and protein purification. These efforts aim to characterize the protein’s structure and function, which could lead to a better understanding of its biological significance and potential applications in biomedicine. Overall, the ongoing research into C8orf34 represents a promising avenue for uncovering new molecular mechanisms and developing innovative strategies for diagnosing or treating diseases linked to its dysregulation.
