Analytical Data
-
Gene name
PPDK
- Application
-
Alternative Names
PPDK;Pyruvate. phosphate dikinase 1. chloroplastic
-
Species
Entamoeba
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37213
-
Expression Region
1-342aa
-
AA Sequence
MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK
-
Molecular Weight
54.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPDK (pyruvate phosphate dikinase) is a crucial enzyme involved in the metabolic pathways of various organisms, particularly in plants and some bacteria. It plays a significant role in regulating energy metabolism by catalyzing the conversion of pyruvate and phosphate into phosphoenolpyruvate (PEP), an essential substrate for numerous biosynthetic processes. Research on PPDK is vital due to its potential applications in agriculture and biotechnology, particularly in enhancing crop yield and stress resilience. Understanding its structure and function can lead to the development of genetically engineered plants with improved photosynthetic efficiency and resource utilization. Furthermore, PPDK's unique properties, such as its allosteric regulation and its role in C4 and CAM (Crassulacean Acid Metabolism) photosynthesis, make it a focal point for investigating carbon fixation mechanisms and optimizing biomass production. Advances in recombinant protein technology have facilitated detailed studies of PPDK, allowing researchers to explore its kinetics, molecular interactions, and functional dynamics more comprehensively. This has implications not just for basic plant biology but also for addressing global challenges like food security and environmental sustainability through innovative agricultural practices.











