Cat: PAX2000-10770

Recombinant Human RASGRF1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RASGRF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CDC25 ; CDC25L; GNRP; GRF1 ; GRF55 ; Guanine nucleotide exchange factor ; Guanine nucleotide releasing factor 55 kD; Guanine nucleotide releasing protein ; guanine nucleotide-releasing factor 1; Guanine nucleotide-releasing protein; H GRF55; HGRF55; PP13187 ; Ras protein specific guanine nucleotide releasing factor 1 ; Ras specific guanine nucleotide releasing factor; Ras specific guanine nucleotide releasing factor CDC25 homolog; Ras specific nucleotide exchange factor CDC25; Ras-GRF1; Ras-specific guanine nucleotide-releasing factor 1; Ras-specific nucleotide exchange factor CDC25; RASGRF1; RGRF1_HUMAN

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13972

  • Expression Region

    1-110 aa

  • AA Sequence

    MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELR

  • Molecular Weight

    37.84 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RASGRF1, a member of the RAS gene family, plays a crucial role as a guanine nucleotide exchange factor (GEF) that activates RAS proteins, which are pivotal in various signaling pathways governing cell proliferation, differentiation, and survival. Alterations in RASGRF1 expression have been associated with several human diseases, including cancer, where its dysregulation can lead to aberrant cell signaling and tumorigenesis. The study of RASGRF1 as a recombinant protein has gained traction due to its potential therapeutic implications; understanding its structure-function relationships and interaction with RAS proteins can provide insights into novel cancer treatments. Furthermore, the investigation of RASGRF1's role in neuronal development and function highlights its significance in neurobiology, as its expression levels are dynamically regulated in the brain. Researchers have been utilizing recombinant DNA technology to produce and characterize RASGRF1, aiming to elucidate its molecular mechanisms and how it influences various cellular processes. Overall, the exploration of RASGRF1 as a recombinant protein opens avenues for targeted therapies and provides a deeper understanding of its contributions to human health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US