Analytical Data
-
Gene name
HLA-DMB
- Application
-
Alternative Names
HLA-DMB;DMB;RING7;HLA class II histocompatibility antigen. DM beta chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28068
-
Expression Region
19-218aa
-
AA Sequence
GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK
-
Molecular Weight
26.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-DMB is a crucial component of the human immune system, specifically within the major histocompatibility complex (MHC) Class II molecules, which play an essential role in the presentation of antigens to CD4+ T cells. Research into HLA-DMB is pertinent due to its involvement in various autoimmune diseases, infectious diseases, and transplant rejection. This protein acts as a chaperone, facilitating the proper assembly and stability of MHC Class II molecules, ensuring that peptide antigens are effectively loaded and presented. Understanding the molecular mechanisms governing HLA-DMB's function could lead to advancements in therapeutic strategies for conditions where immune system dysregulation occurs. Furthermore, studies of HLA-DMB in the context of cancer immunology are gaining attention, as its interactions with tumor-derived peptides may influence the efficacy of T cell responses against neoplastic cells. Given the ongoing challenges in immunotherapy, elucidating the role of HLA-DMB may provide insights that enhance the effectiveness of cancer vaccines and engineered T cell therapies. Overall, the exploration of HLA-DMB recombinant protein facilitates a deeper understanding of immune regulation, paving the way for novel interventions in immunological disorders and cancer treatment.











