Analytical Data
-
Gene name
WAXY
- Application
-
Alternative Names
WAXY；Protein patched homolog 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27736
-
Expression Region
79-349aa
-
AA Sequence
LVFVGAEMAPWSKTGGLGDVLGGLPAAMAANGHRVMVISPRYDQYKDAWDTSVISEIKVVDRYERVRYFHCYKRGVDRVFVDHPCFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALEVPRILDLNNNPHFSGPYAMLCRAVPRRAGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEELISGEARGCELDNIMR
-
Molecular Weight
35.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WAXY, a gene encoding a starch granule-bound protein (GBSS), plays a critical role in starch biosynthesis in plants. Research on WAXY has gained prominence due to its significant impact on the physicochemical properties of starch, which is essential for various applications in food, agriculture, and industrial sectors. Starch polymers, primarily composed of amylose and amylopectin, determine the texture, viscosity, and digestibility of starch-based products. Variation in the WAXY gene can lead to differences in amylose content, which directly influences these properties. For example, higher amylose concentrations typically result in firmer textures and slower digestion rates, making them desirable for specific food applications and health benefits. Moreover, studies have shown that natural mutations in the WAXY gene can enhance the nutritional quality of staple crops, thereby contributing to food security. Genetic engineering approaches are also being explored to optimize WAXY expression levels in crops, aiming to produce starch with tailored characteristics for industrial applications such as biodegradable plastics or biofuels. Overall, understanding the function and regulation of the WAXY gene presents significant opportunities for enhancing crop quality and meeting the rising global demand for diverse starch applications.
