Analytical Data
-
Gene name
C7orf11
- Application
-
Alternative Names
MPLKIP; C7orf11; TTDN1; M-phase-specific PLK1-interacting Protein; TTD non-photosensitive 1 Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAP9
-
Expression Region
1-179aa
-
AA Sequence
MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
-
Molecular Weight
45.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C7orf11, also known as "Chromosome 7 Open Reading Frame 11," is a relatively unexplored protein that has garnered increasing interest in the field of molecular biology and genetics. It is located on human chromosome 7 and is thought to play a role in various cellular processes, although its specific functions remain largely unknown. Recent research has suggested that C7orf11 may be involved in regulating immune responses and cellular signaling pathways, potentially linking it to diseases such as cancer and autoimmune disorders. To elucidate its biological roles, scientists have focused on producing recombinant C7orf11 protein in various expression systems. This approach allows for the functional characterization of the protein, enabling researchers to study its interactions with other biological macromolecules and its potential implications in disease mechanisms. The generation of high-purity recombinant C7orf11 is crucial for biochemical assays, structural biology studies, and potential therapeutic developments. By investigating C7orf11, researchers aim to uncover its physiological relevance and possible involvement in human health and disease, thus contributing to a deeper understanding of the intricate network of proteins that govern cellular functions.
