Cat: PA2000-6314

Recombinant Human C6orf225 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C6orf225

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FAM229B; C6orf225Protein FAM229B

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q4G0N7

  • Expression Region

    1-80aa

  • AA Sequence

    MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK

  • Molecular Weight

    35.2 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C6orf225, also known as the "chromosome 6 open reading frame 225," has emerged as a protein of interest in biomedical research due to its potential involvement in various pathological conditions. Recent advances in genomic and proteomic technologies have facilitated the identification of C6orf225, prompting investigations into its biological functions and implications in health and disease. Initial studies suggest that C6orf225 may play a role in cellular processes such as cell proliferation, differentiation, and apoptosis, which are critical for maintaining tissue homeostasis. Furthermore, preliminary findings indicate a possible correlation between C6orf225 expression levels and certain cancers, as well as autoimmune disorders, raising questions about its utility as a biomarker or therapeutic target. Despite these promising leads, comprehensive functional studies are still required to elucidate the precise mechanisms by which C6orf225 operates at the molecular level. The production of recombinant C6orf225 protein has therefore become a pivotal focus, enabling researchers to conduct in-depth analyses of its structure and function. By understanding the biochemical properties and interaction networks of C6orf225, scientists aim to uncover its role in disease pathology and develop innovative strategies for intervention. This research not only contributes to our fundamental understanding of protein biology but also holds the potential to advance diagnostic and therapeutic approaches in clinical settings. As investigations continue, C6orf225 stands out as a significant candidate for further exploration within the burgeoning field of molecular medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US