Analytical Data
-
Gene name
C6orf199
- Application
-
Alternative Names
AK9; AKD1; AKD2; C6orf199; C6orf224Adenylate kinase 9; AK 9; EC 2.7.4.4; EC 2.7.4.6; Adenylate kinase domain-containing Protein 1; Adenylate kinase domain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TCS8
-
Expression Region
1-421aa
-
AA Sequence
MTSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEVIENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQMVAEILHHLVQRPEDYLENVENIVKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN
-
Molecular Weight
72.05 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf199, also known as Chromosome 6 Open Reading Frame 199, is a relatively uncharacterized gene located on chromosome 6 that has garnered interest in recent years due to its potential roles in various biological processes and diseases. Studies have suggested that C6orf199 may be involved in cellular functions such as proliferation, differentiation, and apoptosis, which are crucial in maintaining tissue homeostasis and responding to environmental stressors. Additionally, emerging evidence indicates its possible association with certain cancers and metabolic disorders, prompting researchers to explore the functional implications of its encoded protein. The recombination and expression of C6orf199 in a heterologous system could facilitate the detailed study of its biochemical properties and interactions with other cellular components. Understanding the structure-function relationships of the C6orf199 protein could offer insights into its biological roles and therapeutic potential, especially in the context of disease modulation. As the research community strives to elucidate the functions of previously uncharacterized proteins, C6orf199 stands out as a candidate for further investigation, particularly regarding its implications in human health and disease.
