Analytical Data
-
Gene name
yihF
- Application
-
Alternative Names
yihF;Uncharacterized Protein YihF
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32128
-
Expression Region
25-476aa
-
AA Sequence
GTQIQPGVEKFIKDFNDAKKKGEHAYDMTLSYQNFDKGFFNSRFQMQMTFDNGAPDLNIKPGQKVVFDVDVEHGPLPITMLMHGNVIPALAAAKVNLVNNELTQPLFIAAKNKSPVEATLRFAFGGSFSTTLDVAPAEYGKFSFGEGQFTFNGDGSSLSNLDIEGKVEDIVLQLSPMNKVTAKSFTIDSLARLEEKKFPVGESESKFNQINIINHGEDVAQIDAFVAKTRLDRVKDKDYINVNLTYELDKLTKGNQQLGSGEWSLIAESIDPSAVRQFIIQYNIAMQKQLAAHPELANDEVALQEVNAALFKEYLPLLQKSEPTIKQPVRWKNALGELNANLDISIADPAKSSSSTNKDIKSLNFDVKLPLNVVTETAKQLNLSEGMDAEKAQKQADKQISGMMTLGQMFQLITIDNNTASLQLRYTPGKVVFNGQEMSEEEFMSRAGRFVH
-
Molecular Weight
66.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The yihF gene, found in various bacterial species, encodes a protein that is involved in the regulation of cell surface properties and biofilm formation. Research on yihF has gained attention due to its potential role in influencing bacterial pathogenesis, antimicrobial resistance, and the overall fitness of bacterial populations in diverse environments. The yihF protein has been implicated in the modulation of intracellular signaling pathways that affect gene expression and metabolic processes. Studies have shown that manipulating yihF expression can alter bacterial adhesion and biofilm formation, which are critical factors in chronic infections and persistent bacterial colonization. Furthermore, exploring the functional properties of the YihF protein through recombinant expression provides insights into its structure and interactions with other cellular components. Understanding yihF's mechanisms could pave the way for the development of novel therapeutic strategies aimed at disrupting biofilm-related infections and enhancing the efficacy of antibiotics. Therefore, the study of yihF and its recombinant protein presents a valuable avenue for advancing our knowledge of bacterial behavior and finding innovative solutions to combat bacterial diseases.











