Analytical Data
-
Gene name
C6orf166
- Application
-
Alternative Names
AKIR2_HUMAN; AKIRIN 2; Akirin-2; Akirin2; C6orf166; dJ486L4.2; FBI1; FLJ10342; Fourteen three three beta interactant 1; OTTHUMP00000016836
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53H80
-
Expression Region
1-203aa
-
AA Sequence
MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS
-
Molecular Weight
48.07 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf166, also known as Chromosome 6 Open Reading Frame 166, is a gene located on chromosome 6 that has garnered interest due to its potential roles in various biological processes. Research indicates that C6orf166 may be involved in cellular functions related to signaling pathways, development, and possibly disease mechanisms, particularly in relation to cancer and neurological disorders. Its protein product is believed to partake in critical cellular activities, prompting investigations into its expression patterns and functional implications. Recent studies have employed recombinant protein techniques to produce C6orf166 in sufficient quantities for in vitro analysis, facilitating the exploration of its biochemical properties and interactions with other cellular components. Understanding the functionality of C6orf166 through recombinant protein studies could provide insights into its role in cellular homeostasis and its potential as a biomarker or therapeutic target in diseases. As the field continues to evolve, further exploration of C6orf166 may lead to significant advances in diagnostic and treatment strategies, highlighting its importance in molecular biology and medicine.
