Analytical Data
-
Gene name
lukF
- Application
-
Alternative Names
lukF;Leukocidin-F subunit
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31715
-
Expression Region
26-323aa
-
AA Sequence
AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
-
Molecular Weight
54.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LukF is a virulence factor produced by Staphylococcus aureus, a significant human pathogen responsible for various infections ranging from minor skin issues to severe systemic diseases. As part of the leukocidin toxin complex, LukF plays a critical role in the bacterium's ability to evade the host immune response by targeting and lysing immune cells, particularly neutrophils. Research on LukF and its partner protein, LukS, has gained importance as understanding their mechanisms can provide insights into the pathogenicity of S. aureus and the development of therapeutic strategies. The assembly of the LukF-LukS heterodimer and its interaction with immune cells is crucial for the toxicity of this leukocidin, making it a valuable target for drug design and vaccine development. Studies have also highlighted the potential for LukF as a biomarker for S. aureus infections, aiding in diagnostic processes. The investigation of LukF's structure, function, and its role in virulence is essential not only for developing new treatment approaches but also for comprehending the broader implications of bacterial toxins in infectious diseases.











