Analytical Data
-
Gene name
C6orf151
- Application
-
Alternative Names
SNRNP48; C6orf151; U11/U12 small nuclear ribonucleoProtein 48 kDa Protein; U11/U12 snRNP 48 kDa Protein; U11/U12-48K
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6IEG0
-
Expression Region
1-339aa
-
AA Sequence
MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIPSITLNKDSQFQIIKQARTAVGKDSDCYNQRIYSSLPVEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDSQIIENDSDLFVDLAAKINQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTEVIRDVINVHMEELSNHWQEEQEKAEDDAEKNEERRSASVDSRQSGGSYLDAECSRHRRDRSRSPHKRKRNKDKDKNCESRRRKERDGERHHSHKRRKQKI
-
Molecular Weight
66.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C6orf151, also known as Chromosome 6 Open Reading Frame 151, is a gene located on human chromosome 6 that encodes a protein with unknown function. Recent studies have suggested its potential role in various biological processes, including cellular signaling and immune responses. The interest in C6orf151 has surged due to its association with certain diseases, including autoimmune disorders and cancers, where dysregulation of its expression may contribute to pathogenesis. As a result, recombinant protein production of C6orf151 has emerged as a significant area of research, aimed at elucidating its structure, function, and interaction with other proteins. By generating and purifying the C6orf151 recombinant protein, researchers can perform biochemical assays, investigate its cellular localization, and evaluate its role in cellular pathways. Understanding the molecular mechanisms underlying C6orf151's function could unveil critical insights into its involvement in disease mechanisms and potentially highlight it as a novel therapeutic target. Overall, the study of C6orf151 and its recombinant protein promises to deepen our understanding of human health and disease, making it a focus of ongoing research efforts in molecular biology and medicine.











