Analytical Data
-
Gene name
AAP1
- Application
-
Alternative Names
AAP1;NAT2;Amino acid permease 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37898
-
Expression Region
1-389aa
-
AA Sequence
MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG
-
Molecular Weight
60.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AAP1 (Amino Acid Permease 1) is an important member of the amino acid transporter family, primarily involved in the uptake and transport of amino acids across cellular membranes. Its role is critical in various biological processes, including nutrient absorption, cellular metabolism, and signaling pathways. Research on AAP1 has gained significant attention due to its potential implications in plant growth, stress response, and adaptation to environmental challenges. Understanding the structure-function relationship of AAP1 and its regulation mechanisms can provide valuable insights into how plants cope with nutrient deficiencies and abiotic stress. Furthermore, the development of recombinant AAP1 proteins facilitates the study of their biochemical properties and interactions with other cellular components. Investigating AAP1’s molecular mechanisms can thus contribute to enhancing crop resilience and productivity, which is crucial for addressing global food security challenges. As a result, AAP1 serves as a promising target for biotechnological applications aimed at improving plant growth and nutrient efficiency, ultimately leading to innovative strategies for sustainable agriculture.











