Analytical Data
-
Gene name
C5orf56
- Application
-
Alternative Names
C5orf56Uncharacterized Protein C5orf56
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N8D9
-
Expression Region
1-126aa
-
AA Sequence
MDSLAAGELNASHQPWVPEFVAYWRKTHQGNLQTLLLHWLLLCSCLHHLYNASCHPAFPVEYSHAVCCLQPRFWKEMSPFSSSSTTHLFSKCFFYTCLCWAWQQCSSEQNHQPCSHAAYNQVERQT
-
Molecular Weight
13.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C5orf56, also known as Chromosome 5 Open Reading Frame 56, is a protein encoded by a gene located on chromosome 5, which has garnered attention due to its potential roles in various biological processes. Initial studies have suggested that C5orf56 may be involved in cellular signaling pathways, cell growth, and differentiation, although its precise functions remain largely unexplored. The lack of detailed research on C5orf56 has prompted scientists to investigate its expression patterns across different tissues and developmental stages, as well as its potential interactions with other proteins. Recent advancements in proteomics and molecular biology techniques have made it feasible to express and purify C5orf56 as a recombinant protein, enabling more in-depth functional studies. Understanding the molecular characteristics and biological functions of C5orf56 is crucial, as it may contribute to our knowledge of gene regulation and cell biology, potentially linking it to various diseases, including cancers and genetic disorders. Therefore, the study of C5orf56 recombinant protein aims to elucidate its role in cellular mechanisms and explore its possible implications in health and disease, paving the way for future therapeutic developments.
