Analytical Data
-
Gene name
C4orf39
- Application
-
Alternative Names
Protein FAM218A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96MZ4
-
Expression Region
1-157aa
-
AA Sequence
MEGCAVRRGSCPLLPGPSAWRASPAGWAGRAKLRSWCRASGLPNRPYTLTGGRHGSVSLLRHPGTTTFVQQRSLHQSWEKRIVFSACPVSRSWCPERNFSGSIPAVTPPKLPGHSKSEGPPGKVRKRTTIRSQPLFVTRTRGFGSAVGWLPLGSPVL
-
Molecular Weight
43.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C4orf39, also known as chromosome 4 open reading frame 39, is a gene that encodes a protein of unknown function, yet it has garnered attention in recent years due to its potential implications in various biological processes and diseases. Research has indicated that C4orf39 may play a role in cellular stress responses, involving mechanisms such as autophagy and apoptosis. The interest in its functional characterization stems from its association with certain conditions, including cancer and neurodegenerative diseases, where altered expression levels may influence disease progression and patient outcomes. The recombinant protein study of C4orf39 aims to elucidate its structural properties and functional mechanisms through expression in various host systems, facilitating the generation of antibodies for detection and characterization. Additionally, understanding the interactions of C4orf39 with other cellular components could offer insights into its biological roles and pathways. Recent advances in proteomic and genomic technologies provide a promising avenue for further exploration of C4orf39, contributing to potential therapeutic targets or biomarkers in relevant diseases. Consequently, the production and analysis of C4orf39 recombinant protein hold significant promise for advancing our understanding of its functions and therapeutic potential.
