Analytical Data
-
Gene name
VACWR034
- Application
-
Alternative Names
VACWR034；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18378
-
Expression Region
1-88aa
-
AA Sequence
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
-
Molecular Weight
11.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VACWR034, a recombinant protein derived from the variola virus, has garnered significant attention in the field of virology and immunology due to its potential implications for vaccine development and therapeutic interventions. With the eradication of smallpox, understanding the genetic and protein structures of related orthopoxviruses, such as VACWR034, is critical for developing novel vaccines and treatments against emerging viral threats. Studies suggest that VACWR034 plays a role in modulating the host immune response, offering insights into how poxviruses evade immune detection. Research on this protein not only enhances our understanding of host-pathogen interactions but also paves the way for innovative therapeutic strategies. The functional characterization of VACWR034 could lead to the identification of key epitopes, ultimately contributing to the design of effective vaccines that leverage the host's immune system to combat viral infections. Furthermore, as global health challenges continue to evolve, the need for robust countermeasures against related viruses becomes increasingly vital, positioning VACWR034 research at the forefront of virologic studies and public health preparedness.
