Analytical Data
-
Gene name
C3orf55
- Application
-
Alternative Names
SLC66A1L; C3orf55; PQLC2L; Putative uncharacterized Protein SLC66A1L; PQ-loop repeat-containing Protein 2-like; Solute carrier family 66 member 1-like
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A1A4F0
-
Expression Region
1-118aa
-
AA Sequence
MKVVGNYRVNTANSSTDTSGEHLTCLRSQLFVAYRNGRVDEAVSLGFLDCWIGGDLTNFKGCYLTNQLPIQIFTAIFDMNTDVIILSQFMYYRLKNQKKKISEEDLRKELHFCCLHWP
-
Molecular Weight
13 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3orf55, or chromosome 3 open reading frame 55, is a gene that has garnered attention in recent years due to its potential involvement in various cellular processes and diseases. Its expression has been linked to several biological functions, including cell proliferation, differentiation, and apoptosis. The protein encoded by C3orf55 is thought to play a role in cellular signaling pathways and may be implicated in the development of cancer, as dysregulation of its expression has been observed in tumor tissues. Researchers have increasingly focused on the production and characterization of recombinant C3orf55 protein to elucidate its molecular mechanisms and biological significance. By expressing C3orf55 in various host systems, scientists aim to purify the protein and perform functional assays, structural studies, and interaction analyses with other cellular proteins. Understanding the role of C3orf55 in health and disease could provide insights into novel therapeutic strategies for targeting related pathologies. The study of this protein is not only important for advancing our comprehension of fundamental biological processes but may also contribute to the development of biomarkers and therapeutic targets in oncology and other fields of medicine.
