Analytical Data
-
Gene name
C3orf56
- Application
-
Alternative Names
C3orf56Putative uncharacterized Protein C3orf56
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N813
-
Expression Region
1-242aa
-
AA Sequence
MGTGASEKQAEQKVRRAFEASEEAHGTLAASTPWVAMGSAYGSCTCLGAQPVTDLALWPVIYSCMGFSPQAYPAFWAYPWVLYGGYLWMGYPPPAALVPSVWLYWRGASSFDPLIGSPYLAALAPNLFPFPMKFPPTYSLASPTLGGATSSHCPQVGCWTPASSAPRAAVEGPSRGAPYLKTCKAPPSEWASRFGIWAPLPCCSSELRPLPPSPIEDSQLDPGCSRSSSRSPCRARRRLFEC
-
Molecular Weight
52.4 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3orf56, or Chromosome 3 Open Reading Frame 56, is a gene located on chromosome 3 that has garnered attention in recent years due to its potential roles in various biological processes and diseases. Research into C3orf56 has revealed its involvement in cellular functions, but the exact biochemical pathways and mechanisms it influences remain largely unexplored. Preliminary studies suggest that C3orf56 might play a role in cell proliferation, apoptosis, and the modulation of signaling pathways, indicating its potential significance in cancer biology and other pathologies. The production of recombinant C3orf56 protein is crucial for further functional studies, allowing researchers to investigate its properties, interactions, and effects in vitro and in vivo. By generating and characterizing this recombinant protein, scientists aim to elucidate its role within the cell and understand its contribution to disease states, thereby laying the groundwork for potential therapeutic interventions or diagnostic applications. Continued research into C3orf56 is essential for unraveling its biological significance and may provide insights into novel mechanisms of disease.











