Cat: PA2000-2509

Recombinant Human UL111A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UL111A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UL111A;IL10R;Interleukin-10 receptor subunit alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    F5HC71

  • Expression Region

    26-176aa

  • AA Sequence

    ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

  • Molecular Weight

    36.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UL111A, a protein encoded by the human cytomegalovirus (HCMV), plays a crucial role in the virus's ability to evade the host immune response. Identified as a multifunctional protein, UL111A functions primarily as a glycoprotein that interacts with various immune receptors, leading to the modulation of immune signaling pathways. Research has shown that UL111A can inhibit the activation of natural killer (NK) cells and T cells, thereby promoting viral persistence and latency. Studies indicate that UL111A achieves this by mimicking host proteins and interfering with cytokine signaling, which are critical for immune activation. Given the prevalence of HCMV in the human population and its potential to cause severe disease in immunocompromised individuals, along with its association with various conditions, including congenital infections and organ transplant rejection, understanding UL111A's mechanisms is essential for developing therapeutic interventions. Recent advancements in recombinant protein technology have enabled the production of UL111A for detailed structural and functional analysis, paving the way for novel vaccine strategies and antiviral therapies that target this viral evasion mechanism. The study of UL111A is not only significant for HCMV pathology but also offers broader insights into viral-host interactions, making it a key target in virology research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US