Analytical Data
-
Gene name
C3orf44
- Application
-
Alternative Names
ERICH6; C3orf44; FAM194A; Glutamate-rich Protein 6; Protein FAM194A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L0X2
-
Expression Region
1-517aa
-
AA Sequence
MSEMSIDRNIHRNLSPGIPVSVQTEESWLQDLSDKVQSRKKASKEKAEPECLASKLREKWVINPEESKLNILYELEFKEDFITLFEPSLRTLPSIGPPSILAYKEESSNLGINFKDEEEETSPKCEFCGSDLRAFFSNVDVSSEPKGHASCCIAFQNLIDYIYEEQIKTKPPKAELIAIDPHAAHGSEVDRLKAKEKALQRKQEQRMARHFAIISREQTHFSEDDSKRLKTISYQLSVDIPEKQIIDDIVFDFQLRNSNMSIICCDSRIACGKVVRNELLEKHYKHGSKFLTSFPDGTTQIFYPSGNLAIIRVPNKVNGFTCIVQEDMPTNPAILAVLDSSGRSSCYHPNGNVWVYINILGGQYSDQAGNRIRAWNWSNSITSSPFVSFKPVFLALNRYIGVRILEQDKISITFLAMGQQARISVGTKVKLPNPEEIPILRYVSGDDLLLLASLIKIRRLFHKLEGCVNFPSSQVWEKLKQPSYLSSLSLKLIALCHSSGIKQDIMKTIRNIINEEI
-
Molecular Weight
85 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3orf44, also known as Chromosome 3 Open Reading Frame 44, is a gene located on chromosome 3 that codes for a protein with an undefined function, which has garnered increasing attention in recent years. Preliminary studies have suggested that C3orf44 may play a role in cellular processes such as proliferation, apoptosis, and potentially in the maintenance of genomic integrity. Its involvement in various biological pathways raises the prospect of C3orf44 being implicated in human diseases, including certain cancers. Furthermore, emerging evidence indicates that C3orf44 may interact with other proteins, suggesting a potential role in protein-protein interactions that are crucial for cellular signaling networks. The recombinant expression of C3orf44 protein serves as a vital tool for elucidating its functional characteristics, interactions, and the mechanisms underlying its biological roles. Researchers are employing techniques such as molecular cloning and expression systems to produce this recombinant protein, enabling detailed biochemical and biophysical characterization. Insights gained from these studies may not only shed light on normal cellular physiology but also clarify the contributions of C3orf44 to pathophysiological conditions. As understanding of C3orf44 continues to expand, it holds promise as a novel biomarker or therapeutic target, warranting further exploration of its potential applications in biomedicine.
