Analytical Data
-
Gene name
C3orf37
- Application
-
Alternative Names
5-Hydroxymethylcytosine (HmC) Binding; ES Cell-Specific; C3orf37; CC037_HUMAN; Chromosome 3 open reading frame 37; DC12; HMECS; MGC111075
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FZ2
-
Expression Region
1-354aa
-
AA Sequence
MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKRPYSQ
-
Molecular Weight
67 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3orf37, also known as Chromosome 3 Open Reading Frame 37, is a gene of interest due to its potential roles in various biological processes and its implications in human diseases. Located on chromosome 3, C3orf37 has been implicated in cellular functions such as proliferation, differentiation, and apoptosis. Recent studies have suggested a possible link between C3orf37 and certain types of cancer, as well as developmental disorders, making it a subject of intensive research. The protein encoded by C3orf37 is thought to participate in critical cellular mechanisms, and understanding its structure and function could provide insights into disease mechanisms. Research on recombinant C3orf37 protein aims to elucidate its biochemical properties and interactions with other proteins, potentially revealing its functional roles in signaling pathways. Advances in proteomics and molecular biology techniques have facilitated the expression and purification of recombinant C3orf37, allowing researchers to investigate its activities in vitro. By creating specific antibodies and conducting various assays, scientists hope to clarify C3orf37's contribution to pathophysiological processes. Ultimately, a comprehensive understanding of C3orf37 may pave the way for novel therapeutic strategies targeting diseases associated with its dysfunction.
