Analytical Data
-
Gene name
C3orf36
- Application
-
Alternative Names
C3orf36Uncharacterized Protein C3orf36
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3SXR2
-
Expression Region
1-165aa
-
AA Sequence
MQAETILEGLEAGLPQAVSSGLSLVPAPGLVLTCLSAPSGPGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRRSPPACSQHTPPLPSTPTGPPPCSPGGNHPLCALSGRGGGRCSIPSLSSSSTFSLFSSGCWNPRVKLRVRKSQSQGRAGQLI
-
Molecular Weight
43.3 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3orf36, also known as Chromosome 3 Open Reading Frame 36, is a protein-coding gene located on chromosome 3 that has garnered attention due to its potential roles in various biological processes and diseases. Research has indicated that C3orf36 may be involved in cellular functions such as proliferation, differentiation, and metabolic regulation. Despite its potential significance, the exact biological functions and mechanisms of action of C3orf36 remain largely unexplored, necessitating further investigation. Studies have suggested that alterations in C3orf36 expression could be linked to several pathological conditions, including cancer and neurological disorders, highlighting the necessity for detailed research into its role in these diseases. The gene's reorganization and potential interactions with other cellular pathways provide a promising avenue for understanding its implications in health and disease. As such, dissecting the structure and function of C3orf36 could uncover novel therapeutic targets and biomarkers for diagnosis and treatment, making it a compelling subject for ongoing scientific inquiry.
