Cat: PA2000-6250

Recombinant Human C3orf36 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C3orf36

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C3orf36Uncharacterized Protein C3orf36

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q3SXR2

  • Expression Region

    1-165aa

  • AA Sequence

    MQAETILEGLEAGLPQAVSSGLSLVPAPGLVLTCLSAPSGPGGMALEPPPTTLRKAFLAQSTLLESTLEGAPEWAAPHPEEQRRSPPACSQHTPPLPSTPTGPPPCSPGGNHPLCALSGRGGGRCSIPSLSSSSTFSLFSSGCWNPRVKLRVRKSQSQGRAGQLI

  • Molecular Weight

    43.3 KDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C3orf36, also known as Chromosome 3 Open Reading Frame 36, is a protein-coding gene located on chromosome 3 that has garnered attention due to its potential roles in various biological processes and diseases. Research has indicated that C3orf36 may be involved in cellular functions such as proliferation, differentiation, and metabolic regulation. Despite its potential significance, the exact biological functions and mechanisms of action of C3orf36 remain largely unexplored, necessitating further investigation. Studies have suggested that alterations in C3orf36 expression could be linked to several pathological conditions, including cancer and neurological disorders, highlighting the necessity for detailed research into its role in these diseases. The gene's reorganization and potential interactions with other cellular pathways provide a promising avenue for understanding its implications in health and disease. As such, dissecting the structure and function of C3orf36 could uncover novel therapeutic targets and biomarkers for diagnosis and treatment, making it a compelling subject for ongoing scientific inquiry.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US