Analytical Data
-
Gene name
tpd
- Application
-
Alternative Names
tpd;Tumor Protein D54
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19478
-
Expression Region
20-204aa
-
AA Sequence
CGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
-
Molecular Weight
27.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPD (Tobacco Products Directive) recombinant proteins have gained significant attention in recent years due to their potential applications in biotechnology and pharmaceutical research. These proteins, derived from specific genes, serve as valuable tools for studying protein interactions, functional characterization, and the development of novel therapeutic agents. The focus on TPD recombinant proteins is partly driven by the increasing demand for sustainable and efficient production methods in the life sciences, as traditional protein expression systems often face limitations in yield and functionality. Moreover, TPD-associated research seeks to explore the molecular mechanisms underlying plant resistance to pathogens, which can inform the development of genetically engineered crops with enhanced resilience. As global health concerns and agricultural challenges persist, the investigation into TPD recombinant proteins not only promises advancements in our understanding of plant biology but also holds the potential for innovative solutions in medical and agricultural biotechnology. By employing cutting-edge techniques such as CRISPR-Cas9 and high-throughput screening, researchers aim to unlock the full potential of TPD proteins, paving the way for breakthroughs in disease treatment and food security. Overall, the study of TPD recombinant proteins represents a critical intersection of plant science, molecular biology, and biotechnology, underscoring its importance in addressing contemporary challenges in health and agriculture.











