Analytical Data
-
Gene name
C3orf26
- Application
-
Alternative Names
CMSS1; C3orf26Protein CMSS1; Cms1 ribosomal small subunit homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQ75
-
Expression Region
1-279aa
-
AA Sequence
MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKGICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF
-
Molecular Weight
58.2 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3orf26, also known as Chromosome 3 Open Reading Frame 26, is a gene located on chromosome 3 that has garnered attention due to its potential implications in human health and disease. Its function has remained largely elusive, but emerging evidence suggests a role in various cellular processes, including cell differentiation, proliferation, and apoptosis. Recent studies have indicated that C3orf26 may be involved in the development of certain cancers and inherited disorders, highlighting its significance in genetic research. The recombinant protein of C3orf26 is particularly important for elucidating its biochemical properties and interactions within biological pathways. Researchers have begun to explore the structural and functional characteristics of the C3orf26 protein, utilizing recombinant DNA technology to produce the protein in vitro. This approach allows for detailed analysis of its function, including protein structure, expression patterns, and potential interactions with other biomolecules. The study of C3orf26 recombinant protein aims to reveal insights into its role in pathophysiological contexts and could pave the way for developing targeted therapies. Additionally, understanding the post-translational modifications and interactions of C3orf26 may uncover novel diagnostic markers or therapeutic targets for diseases associated with its dysregulation. Overall, the investigation of C3orf26 and its recombinant protein represents a promising frontier in molecular biology and genetic research, with the potential to contribute significantly to our understanding of gene function and its implications for human health.
