Analytical Data
-
Gene name
K3L
- Application
-
Alternative Names
K3L；CD158Z；KIR3DL7；KIRC1；Killer cell immunoglobulin-like receptor 3DL3
-
Species
Vaccinia
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20639
-
Expression Region
1-88aa
-
AA Sequence
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
-
Molecular Weight
26.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
K3L is a recombinant protein derived from the vaccinia virus, known for its ability to inhibit the antiviral effects of interferons, which are key components of the innate immune response. Research into K3L has gained momentum due to its potential applications in both virology and therapeutic development. Interferons play a critical role in the body’s defense against viral infections by activating genes that promote antiviral states in neighboring cells. However, many viruses, including vaccinia, have evolved mechanisms to counteract these defenses, with K3L being one such mechanism. By understanding the structure and function of K3L, scientists aim to unveil the molecular interactions that facilitate its antiviral properties, providing insights into viral pathogenesis and host-virus interactions. Moreover, K3L’s unique ability to mimic host proteins that inhibit antiviral signaling pathways opens avenues for developing novel antiviral strategies and therapeutic agents. The study of K3L may also enhance our understanding of immune evasion strategies employed by various pathogens, paving the way for innovative treatments against viral infections. Thus, the research on K3L not only contributes to virology but also holds promise for broader implications in immunology and therapeutic development.
