Cat: PA2000-2491

Recombinant E.coli nifH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    nifH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    nifH;Nitrogenase iron Protein

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20623

  • Expression Region

    1-47aa

  • AA Sequence

    MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ

  • Molecular Weight

    35.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The nifH gene encodes a critical component of the nitrogenase enzyme complex responsible for nitrogen fixation in various bacteria, including those forming symbiotic relationships with plants. Research on recombinant NifH proteins has gained attention due to their potential applications in agriculture and biotechnology, particularly in improving soil fertility and crop productivity by enhancing nitrogen availability. Understanding the structure and function of NifH at the molecular level is vital, as this enables scientists to elucidate the enzymatic mechanisms involved in nitrogen fixation. Moreover, advances in genetic engineering and protein expression technologies have facilitated the production of recombinant NifH proteins, allowing researchers to study their activity, stability, and interaction with other nitrogenase components. Investigating these proteins can provide insights into the evolutionary adaptations of nitrogen-fixing organisms and may lead to innovative strategies for developing biofertilizers or engineering nitrogen-fixing capabilities in non-leguminous crops, thereby promoting sustainable agricultural practices. This research not only addresses the pressing need for sustainable food production in the face of global challenges such as climate change and soil depletion but also contributes to a fundamental understanding of nitrogen metabolism in the biosphere.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US