Analytical Data
-
Gene name
C3orf24
- Application
-
Alternative Names
FANCD2OS; C3orf24; HSD19FANCD2 opposite strand Protein; Fanconi anemia group D2 Protein opposite strand transcript Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96PS1
-
Expression Region
1-177aa
-
AA Sequence
MAGYQLWSPWTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRVSDKSAFCKIISREHQWPIGLKEPQIQMTVTMCKQMLRSILLLYATYKKCTFALQHSK
-
Molecular Weight
46.6 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3orf24, also known as Chromosome 3 Open Reading Frame 24, has emerged as a protein of interest in molecular biology due to its potential roles in various cellular processes and disease mechanisms. Initially identified through genomic analyses, C3orf24 is located on chromosome 3 and encodes a protein whose exact biological function remains largely elusive. Recent studies have suggested that C3orf24 may be involved in critical pathways related to cell proliferation, apoptosis, and immune response regulation. Its expression levels have been found to vary in different cancers, positioning C3orf24 as a potential biomarker for tumor progression and a target for therapeutic interventions. Additionally, research has indicated possible interactions between C3orf24 and other proteins, hinting at its involvement in complex cellular networks. Ongoing investigations aim to elucidate the protein's structural characteristics through recombinant expression systems, allowing for in-depth functional analyses. Understanding C3orf24's role could provide insights into its contribution to oncogenesis and other pathologies, highlighting the necessity for further explorations in both basic and applied research settings.











