Analytical Data
-
Gene name
C2orf60
- Application
-
Alternative Names
TYW5; C2orf60; tRNA wybutosine-synthesizing Protein 5; hTYW5; EC 1.14.11.42; tRNA(Phe; 7-(3-amino-3-carboxypropyl)wyosine(37)-C(2))-hydroxylase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A2RUC4
-
Expression Region
1-152aa
-
AA Sequence
MDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE
-
Molecular Weight
43.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C2orf60, also known as chromosome 2 open reading frame 60, is a relatively less-studied protein whose function and biological significance are beginning to come into focus. Research into C2orf60 has gained momentum due to its potential involvement in various cellular processes, including transcription regulation and cell signaling pathways. Initial studies have suggested that this protein may play a role in cellular stress responses and is potentially implicated in certain diseases, including cancer. The need for a detailed understanding of C2orf60’s structure and function has prompted the development of recombinant protein systems, allowing for the expression and purification of C2orf60 for functional assays. Investigating its biochemical properties, interaction networks, and regulatory mechanisms is crucial for elucidating its role in human health and disease. Furthermore, ongoing research efforts aim to explore the therapeutic potential of targeting C2orf60 in the context of disease pathology. The development of C2orf60 recombinant proteins can provide insight into the mechanisms by which this protein operates within the cell, thus offering a promising avenue for advancing our understanding of its contributions to biological systems and its potential as a drug target in clinical applications.
