Analytical Data
-
Gene name
HLA-E
- Application
-
Alternative Names
HLA-E;HLA-6.2;HLAE;HLA class I histocompatibility antigen. alpha chain E
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13747
-
Expression Region
22-305aa
-
AA Sequence
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAP WMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHG CELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDA SEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEAT LRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVP SGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI
-
Molecular Weight
49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-E is a non-classical MHC (Major Histocompatibility Complex) molecule that plays a crucial role in the immune system, particularly in the regulation of natural killer (NK) cells and certain T-cell responses. Unlike classical MHC molecules, HLA-E primarily presents peptides derived from other MHC class I molecules, which helps in modulating immune tolerance and protecting cells from NK cell-mediated lysis. The study of HLA-E recombinantly expressed proteins has gained significant attention due to its potential implications in transplantation, tumor immunology, and viral infections. Researchers are particularly interested in the structure and function of HLA-E-recombinant proteins to understand their interactions with NK cell receptors, such as NKG2A and NKG2C. Furthermore, the ability to produce HLA-E in a recombinant form facilitates investigations into its use as a therapeutic target or biomarker for various diseases, including cancers and viral infections, where modulation of immune responses is crucial. As a result, ongoing research aims to delineate the precise biochemical properties of HLA-E, its peptide-binding capabilities, and its role in immune evasion, paving the way for novel immunotherapeutic strategies.











