Analytical Data
-
Gene name
C2orf51
- Application
-
Alternative Names
TEX37; C2orf51; TSC21; Testis-expressed sequence 37 Protein; Testis-specific conserved Protein of 21 kDa
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96LM6
-
Expression Region
1-180aa
-
AA Sequence
MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQ
-
Molecular Weight
47 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C2orf51, also known as "chromosome 2 open reading frame 51," is a relatively less characterized protein that has gained attention in recent years due to its potential roles in various biological processes. Research has indicated that C2orf51 may be involved in cellular functions such as gene regulation, cell signaling, and possibly in the mechanisms underlying certain diseases. Its expression patterns have been noted in several tissues, suggesting a potential role in development and differentiation. Furthermore, alterations in C2orf51 expression have been linked to pathological conditions, including cancers and neurodegenerative diseases, prompting investigations into its function and significance. The production and study of recombinant C2orf51 protein are crucial for elucidating its structural and functional properties, enabling researchers to explore its interactions with other cellular molecules and pathways. Understanding C2orf51 can provide insights into its biological roles and therapeutic potential, making it a target of interest in molecular biology and medical research. The ongoing studies aim to clarify its role in health and disease, paving the way for possible applications in diagnostics and targeted treatments.
