Analytical Data
-
Gene name
C21orf59
- Application
-
Alternative Names
C21orf48; C21orf59; Chromosome 21 open reading frame 59; CILD26; CU059_HUMAN; FBB18; FLJ20467; FLJ37137; FLJ40247; Prostate cancer upregulated Protein 1; Uncharacterized Protein C21orf59
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P57076
-
Expression Region
1-290aa
-
AA Sequence
MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR
-
Molecular Weight
59.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C21orf59, also known as "Chromosome 21 Open Reading Frame 59," has emerged as a significant protein in various biological studies, particularly in relation to cell growth and differentiation. Located on chromosome 21, it draws interest due to its potential implications in genetic disorders, including Down syndrome, where the overexpression of genes on this chromosome may contribute to the phenotypic traits observed in affected individuals. Recent research has focused on the recombinant expression of C21orf59 to better understand its functional role and interactions within cellular mechanisms. The availability of high-purity recombinant C21orf59 protein allows for in-depth analysis through biophysical and biochemical assays. These studies aim to elucidate its structure-function relationship, revealing how C21orf59 may participate in cellular pathways and influencing various diseases. Furthermore, understanding C21orf59’s role can provide insights into novel therapeutic targets for related genetic conditions. With advancements in recombinant DNA technology and protein purification methods, the investigation into C21orf59 is paving the way for significant breakthroughs in both basic research and potential clinical applications, highlighting the importance of this protein in the realm of molecular biology and genetics.
