Analytical Data
-
Gene name
C20orf30
- Application
-
Alternative Names
TMEM230; C20orf30; HSPC274; UNQ2432/PRO4992; Transmembrane Protein 230
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96A57
-
Expression Region
1-120aa
-
AA Sequence
MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
-
Molecular Weight
38.94 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf30, also known as BRCC3, is a gene located on chromosome 20, encoding a protein that plays a significant role in cellular processes such as DNA damage repair, cell cycle regulation, and apoptosis. Recent studies have identified C20orf30 as a crucial player in the maintenance of genomic stability, particularly in its involvement in the repair of double-strand DNA breaks through the homologous recombination pathway. The protein's function is closely linked to cancer biology, as its dysregulation has been associated with various malignancies, including breast and ovarian cancers. Moreover, C20orf30 has been implicated in cellular responses to oxidative stress and DNA damaging agents, suggesting its potential role in protective mechanisms against tumorigenesis. Given these critical functions, researchers have focused on the characterization and production of recombinant C20orf30 protein to explore its biochemical properties and interactions with other cellular factors. Understanding the structure-function relationship of this protein may provide insights into its mechanisms of action and pave the way for developing targeted therapies in cancers where C20orf30 is involved. Such research not only enhances our knowledge of cancer biology but also opens avenues for novel therapeutic strategies aimed at restoring the normal function of this protein in affected cells.
