Analytical Data
-
Gene name
C20orf29
- Application
-
Alternative Names
AP-5 complex subunit sigma-1. Adaptor-related Protein complex 5 sigma subunit. Sigma5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUS5
-
Expression Region
1-200aa
-
AA Sequence
MVHAFLIHTLRAPNTEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLLRKEQILAVARQVESMCRLQQQASGRPPMDLQPQSSDEQVPLHEAPRGAFRLAAENPFQEPRTVVWLGVLSLGFALVLDAHENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAWPR
-
Molecular Weight
48.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf29, also known as chromosome 20 open reading frame 29, is a gene located on human chromosome 20, and its protein product has garnered interest due to its potential role in various cellular processes. Despite the lack of extensive characterization, preliminary studies suggest that C20orf29 may be involved in critical functions such as intracellular signaling and gene regulation. The protein's expression patterns, particularly in different tissues and under various pathological conditions, hint at its importance in development and disease. Recent advances in proteomics and molecular biology techniques have enabled researchers to produce and study recombinant C20orf29 proteins, facilitating the exploration of their structural and functional properties. Understanding the biochemical characteristics of C20orf29 can provide insights into its potential involvement in diseases, including cancer and neurodegenerative disorders, where abnormal gene expression and protein function are often implicated. Furthermore, the generation of a recombinant version of C20orf29 could serve as a valuable tool for the development of targeted therapies or diagnostic markers. Overall, the study of C20orf29 represents a promising avenue for advancing our understanding of gene function and its implications in human health.
