Analytical Data
-
Gene name
C20orf20
- Application
-
Alternative Names
MRGBP; C20orf20; MRG/MORF4L-binding Protein; MRG-binding Protein; Up-regulated in colon cancer 4; Urcc4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NV56
-
Expression Region
1-204aa
-
AA Sequence
MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT
-
Molecular Weight
48.8 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf20, a gene located on chromosome 20, has garnered attention in the field of molecular biology due to its potential roles in various cellular processes. Research indicates that C20orf20 may be involved in the regulation of cell proliferation, differentiation, and apoptosis, suggesting its relevance in developmental biology and cancer research. The gene has been implicated in several diseases, including certain types of cancer, which highlights the importance of understanding its function and the mechanisms underlying its influence on cellular behavior. Despite these associations, the specific biological roles of the C20orf20 protein remain largely unexplored. Recent advancements in recombinant protein technology have made it possible to produce C20orf20 in a laboratory setting, allowing researchers to study its structure and functional properties in greater detail. By generating recombinant C20orf20 protein, scientists can perform various assays to investigate its interactions with other proteins, its enzymatic activity, and its role in signaling pathways. This research is crucial for elucidating the biological significance of C20orf20, potentially leading to breakthroughs in therapeutic strategies for diseases linked to its dysregulation. Overall, studying C20orf20 through recombinant protein approaches promises to enhance our understanding of its cellular functions and may contribute to the development of targeted treatments in the future.
